Recombinant Human SLC9A3R1 Protein, N-His

Recombinant Human SLC9A3R1 Protein, N-His

100%
Manufactured by:ProteoGenix
Save 20%RUO

Recombinant Human SLC9A3R1 Protein, N-His

Recombinant Human SLC9A3R1 Protein, N-His from ProteoGenix; catalogue ARO-P10171; research use only.

SKU:
ABM140328-1
Manufacturer SKU
ARO-P10171
Product type
Recombinant Proteins
Expression systemProkaryotic expression

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Recombinant Human SLC9A3R1 Protein, N-His is a ProteoGenix recombinant protein supplied under catalogue number ARO-P10171 for research use only.

Host: Escherichia coli (E.coli); Expression system: Prokaryotic expression; Molecular weight: 14.70 kDa; Fragment: Met1-Ala116; Buffer: Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol..

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications
Also known as
Na(+)/H(+) exchange regulatory cofactor NHE-RF1, NHERF-1, Ezrin-radixin-moesin-binding phosphoprotein 50, EBP50, Regulatory cofactor of Na(+)/H(+) exchanger, Sodium-hydrogen exchanger regulatory factor 1, Solute carrier family 9 isoform A3 regulatory factor 1, NHERF1, NHERF, SLC9A3R1
Host species
E. coli
Source organism
Human
Molecular weight
14.70 kDa
Sequence fragment
Met1-Ala116
Sequence
MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEA
Technical note
For research use only.
Identifiers & database references
Manufacturer SKU
ARO-P10171
UniProt accession
O14745
Storage, stability & shipping
Storage conditions
4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Shipped at
Dry Ice
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£185.00£148.00