Recombinant Human CAPRIN1 Protein, N-His-SUMO & C-Strep

Recombinant Human CAPRIN1 Protein, N-His-SUMO & C-Strep from ProteoGenix; catalogue ARO-P12592; research use only.

SKU:: ABM143032-1
Manufacturer SKU: ARO-P12592
RRID
Product type: Recombinant Proteins

Expression systemProkaryotic expression

Manufacturer provenance

Manufactured by:: ProteoGenix
Sold by:: ABMIUM
Fulfilled from:: Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Recombinant Human CAPRIN1 Protein, N-His-SUMO & C-Strep is a ProteoGenix recombinant protein supplied under catalogue number ARO-P12592 for research use only.

Host: Escherichia coli (E.coli); Expression system: Prokaryotic expression; Molecular weight: 27.85 kDa; Fragment: Arg132-Asn251; Buffer: Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol..

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications

Also known as: GPI-anchored protein p137, Cytoplasmic activation- and proliferation-associated protein 1, p137GPI, RNG105, M11S1, Caprin-1, Cell cycle-associated protein 1, RNA granule protein 105, CAPRIN1, GPIP137, GPI-anchored membrane protein 1, GPI-p137, GPIAP1, Membrane component chromosome 11 surface marker 1
Host species: E. coli
Source organism: Human
Molecular weight: 27.85 kDa
Sequence fragment: Arg132-Asn251
Sequence: RREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHN
Technical note: For research use only.

Identifiers & database references

Manufacturer SKU: ARO-P12592
UniProt accession: Q14444

Storage, stability & shipping

Storage conditions: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Shipped at: Dry Ice

Compliance & documents

ISO certifications: ISO 9001:2023, ISO 14001: 2023
Datasheet: Open datasheet

Frequently asked questions

Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

Delivery to United Kingdom: typically 1 to 3 business days in transit Transit estimate after dispatch. Final shipping options are confirmed at checkout.