Monkeypox virus/MPXV D6L Recombinant Protein, N-His

SDS-PAGE For Monkeypox virus/MPXV D6L Recombinant Protein, N-His

100%
Manufactured by:ProteoGenix
Save 20%RUO

Monkeypox virus/MPXV D6L Recombinant Protein, N-His

Monkeypox virus/MPXV D6L Recombinant Protein, N-His from ProteoGenix; catalogue PX-P6080; research use only.

SKU:
ABM145073-1
Manufacturer SKU
PX-P6080
Product type
Recombinant Proteins
ApplicationsWB, ELISA
Expression systemProkaryotic expression
Purity>85% by SDS-PAGE

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Monkeypox virus/MPXV D6L Recombinant Protein, N-His is a ProteoGenix recombinant protein supplied under catalogue number PX-P6080 for research use only.

Host: Escherichia coli (E.coli); Expression system: Prokaryotic expression; Purity: >85% by SDS-PAGE; Molecular weight: 16.44 kDa; Tag: N-terminal His Tag; Fragment: Met1-Lys126; Buffer: Supplied as solution form in PBS pH 7.4.; Applications: WB, ELISA.

Key facts & specifications
Also known as
Interleukin-18-binding protein, D6L, Monkeypox virus (MPXV), clade 2
Host species
Escherichia coli (E.coli)
Source organism
Monkeypox virus (strain Zaire-96-I-16) (MPX)
Tag
N-terminal His Tag
Molecular weight
16.44 kDa
Sequence fragment
Met1-Lys126
Sequence
MRILFLIAFMYGCVHSYVNAVETKCPNLAIVTSSGEFHCSGCVERMPGFSYMYWLANDMKSDEDTKFIEHLGGGIKEDETVRTTDGGITTLRKVLHVTDTNKFAHYRFTCVLITLDGVSKKNIWLK
Technical note
For research use only.
Identifiers & database references
Manufacturer SKU
PX-P6080
UniProt accession
A0A7H0DMZ8
Storage, stability & shipping
Storage conditions
4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Shipped at
Dry Ice
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£249.00£199.20