Save 20%RUO

InVivoMAb Anti-Human SNCA Antibody (9E4#)

InVivoMAb Anti-Human SNCA Antibody (9E4#) from ProteoGenix; catalogue ARO-A13058; research use only.

SKU:: ABM129097-1
Manufacturer SKU: ARO-A13058
RRID
Product type: Primary Antibodies

TargetInVivoMAb Anti-Human SNCA

Species / reactivityHuman

Manufacturer provenance

Manufactured by:: ProteoGenix
Sold by:: ABMIUM
Fulfilled from:: Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

InVivoMAb Anti-Human SNCA Antibody (9E4#) is a ProteoGenix primary antibody supplied under catalogue number ARO-A13058 for research use only.

Target: InVivoMAb Anti-Human SNCA; Host: Human; Clonality: Monoclonal Antibody; Buffer: 0.01M PBS, pH 7.4.; Reactivity: Human.

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications

Also known as: Anti-SNCA
Host species: Human
Clonality: Monoclonal
Source organism: Human
Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Identifiers & database references

Manufacturer SKU: ARO-A13058
UniProt accession: P37840

Storage, stability & shipping

Storage conditions: Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Shipped at: Blue ice (+4°C)

Compliance & documents

ISO certifications: ISO 9001:2023, ISO 14001: 2023
Datasheet: Open datasheet

Frequently asked questions

Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

Delivery to United Kingdom: typically 1 to 3 business days in transit Transit estimate after dispatch. Final shipping options are confirmed at checkout.