InVivoMAb Anti-Brazilian scorpion Tityustoxin VII/Toxin VII/Ts7 Antibody (Iv0135)

SDS-PAGE for InVivoMAb Anti-Brazilian scorpion Tityustoxin VII/Toxin VII/Ts7 Antibody (Iv0135)

100%
Manufactured by:ProteoGenix
Save 20%RUO

InVivoMAb Anti-Brazilian scorpion Tityustoxin VII/Toxin VII/Ts7 Antibody (Iv0135)

InVivoMAb Anti-Brazilian scorpion Tityustoxin VII/Toxin VII/Ts7 Antibody (Iv0135) from ProteoGenix; catalogue ARO-A13233; research use only.

SKU:
ABM129272-1
Manufacturer SKU
ARO-A13233
Product type
Primary Antibodies
TargetBeta-mammal/insect toxin Ts1

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

InVivoMAb Anti-Brazilian scorpion Tityustoxin VII/Toxin VII/Ts7 Antibody (Iv0135) is a ProteoGenix primary antibody supplied under catalogue number ARO-A13233 for research use only.

Target: Beta-mammal/insect toxin Ts1; Host: Human; Clonality: Monoclonal Antibody; Buffer: 0.01M PBS, pH 7.4..

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications
Also known as
Anti-Beta-mammal/insect toxin Ts1, Beta-like toxin Ts1, PT-Mice-Ins-beta NaTx6.1, Tityustoxin VII, Toxin VII, Ts VII, Ts7, TsTX-VII, Toxin II-11, Toxin III-10, Toxin T2-IV, Toxin gamma, T-gamma, TiTx gamma, Toxin-g, TsTX-I
Host species
Human
Clonality
Monoclonal
Source organism
Human
Sequence
MKGMILFISCLLLIGIVVECKEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKCGKK
Identifiers & database references
Manufacturer SKU
ARO-A13233
UniProt accession
P15226
Storage, stability & shipping
Storage conditions
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Shipped at
Blue ice (+4°C)
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£289.00£231.20