Human JMJD1C Recombinant Protein, N-His

Human JMJD1C Recombinant Protein, N-His

100%
Manufactured by:ProteoGenix
Save 20%RUO

Human JMJD1C Recombinant Protein, N-His

Human JMJD1C Recombinant Protein, N-His from ProteoGenix; catalogue ARO-P20038; research use only.

SKU:
ABM136260-1
Manufacturer SKU
ARO-P20038
Product type
Recombinant Proteins
Expression systemProkaryotic expression

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Human JMJD1C Recombinant Protein, N-His is a ProteoGenix recombinant protein supplied under catalogue number ARO-P20038 for research use only.

Host: Escherichia coli (E.coli); Expression system: Prokaryotic expression; Molecular weight: 43.62 kDa; Tag: N-Terminal His Tag; Fragment: Glu2141-Glu2502; Buffer: Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol..

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications
Also known as
EC:1.14.11.-, JHDM2C, JMJD1C, Jumonji domain-containing protein 1C, KIAA1380, Probable JmjC domain-containing histone demethylation protein 2C, TR-interacting protein 8, TRIP-8, TRIP8, Thyroid receptor-interacting protein 8
Host species
E. coli
Source organism
Human
Tag
N-Terminal His Tag
Molecular weight
43.62 kDa
Form / buffer
Liquid
Sequence fragment
Glu2141-Glu2502
Sequence
ESIISAVDENNKLYSDIPHSWICEKHILWLKDYKNSSNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQADLLNCKDSIISNANVKEFWDGFEEVSKRQKNKSGETVVLKLKDWPSGEDFKTMMPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELRLLKE
Technical note
For research use only.
Identifiers & database references
Manufacturer SKU
ARO-P20038
UniProt accession
Q15652
Storage, stability & shipping
Storage conditions
4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Shipped at
Dry Ice
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£225.00£180.00