Human DYNLL2 Recombinant Protein, N-GST & C-His

Human DYNLL2 Recombinant Protein, N-GST & C-His

100%
Manufactured by:ProteoGenix
Save 20%RUO

Human DYNLL2 Recombinant Protein, N-GST & C-His

Human DYNLL2 Recombinant Protein, N-GST & C-His from ProteoGenix; catalogue ARO-P20543; research use only.

SKU:
ABM135880-1
Manufacturer SKU
ARO-P20543
Product type
Recombinant Proteins
Expression systemProkaryotic expression

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Human DYNLL2 Recombinant Protein, N-GST & C-His is a ProteoGenix recombinant protein supplied under catalogue number ARO-P20543 for research use only.

Host: Escherichia coli (E.coli); Expression system: Prokaryotic expression; Molecular weight: 38.40 kDa; Tag: N-Terminal GST and C-Terminal His Tag; Fragment: Ser2-Gly89; Buffer: Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol..

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications
Also known as
8 kDa dynein light chain b, DLC2, DLC8b, DYNLL2, Dynein light chain 2, cytoplasmic, Dynein light chain LC8-type 2
Host species
E. coli
Source organism
Human
Tag
N-Terminal GST and C-Terminal His Tag
Molecular weight
38.40 kDa
Form / buffer
Liquid
Sequence fragment
Ser2-Gly89
Sequence
SDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Technical note
For research use only.
Identifiers & database references
Manufacturer SKU
ARO-P20543
UniProt accession
Q96FJ2
Storage, stability & shipping
Storage conditions
4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Shipped at
Dry Ice
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£219.00£175.20