ABMIUM
Manufactured by:ProteoGenix
Save 20%RUO

FAS Protein- Human Factor Related Apoptosis Recombinant protein

FAS Protein- Human Factor Related Apoptosis Recombinant protein from ProteoGenix; catalogue PX-P4017; research use only.

SKU:
ABM146281-1
Manufacturer SKU
PX-P4017
Product type
Recombinant Proteins
ApplicationsWB, ELISA
Expression systemEukaryotic expression
Purity80%

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

FAS Protein- Human Factor Related Apoptosis Recombinant protein is a ProteoGenix recombinant protein supplied under catalogue number PX-P4017 for research use only.

Host: Mammalian cells; Expression system: Eukaryotic expression; Purity: 80%; Molecular weight: 20,22 kDa; Tag: Yes; Fragment: Partial; Buffer: 50 mM Tris-HCl, pH 8.0, 150 mM NaCl; Applications: WB, ELISA.

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Download the manufacturer safety data sheet (MSDS/SDS)

Key facts & specifications
Also known as
ALPS 1A, ALPS1A, APO 1, Apo 1 antigen, APO 1 cell surface antigen, Apo-1 antigen, APO1, Apo1 antigen, APO1 cell surface antigen, Apoptosis antigen 1, Apoptosis mediating surface antigen FAS, Apoptosis-mediating surface antigen FAS, APT 1, APT1, CD 95, CD 95 antigen, CD95, CD95 antigen, Delta Fas, Delta Fas/APO 1/CD95, Delta Fas/APO1/CD95, Fas, Fas (TNF receptor superfamily, member 6), FAS 1, FAS 827dupA, Fas AMA, FAS Antigen, Fas cell surface death receptor, FAS1, FASLG receptor, FASTM, sFAS, Surface antigen APO1, TNF receptor superfamily, member 6, TNFRSF 6, TNFRSF6, TNR6_HUMAN, Tumor necrosis factor receptor superfamily member 6
Host species
Mammalian cells
Source organism
Homo sapiens (Human)
Tag
Yes
Molecular weight
20,22 kDa
Form / buffer
Lyophilized
Sequence fragment
Partial
Sequence
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNGSHHHHHH
Technical note
For research use only
Identifiers & database references
Manufacturer SKU
PX-P4017
UniProt accession
P25445
Storage, stability & shipping
Storage conditions
FAS protein is stored: At 4°C for short term period (less than a week) At -20°C or -80°C for long term period Recommendations It is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection
Shipped at
Dry Ice
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Safety data sheet
Open SDS
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£249.00£199.20