ABMIUM
Manufactured by:ProteoGenix
Save 20%RUO

Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)

Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8) from ProteoGenix; catalogue PX-P4698; research use only.

SKU:
ABM146287-1
Manufacturer SKU
PX-P4698
Product type
Recombinant Proteins
ApplicationsWB, ELISA
Expression systemProkaryotic expression
Purity>90% by SDS-PAGE

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8) is a ProteoGenix recombinant protein supplied under catalogue number PX-P4698 for research use only.

Host: Escherichia coli (E.coli); Expression system: Prokaryotic expression; Purity: >90% by SDS-PAGE; Molecular weight: 27kDa&28kDa; Tag: C-terminal His Tag; Fragment: Met1-Lys239 & Trp137-Cys387; Buffer: PBS, pH7.5; Applications: WB, ELISA.

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Download the manufacturer safety data sheet (MSDS/SDS)

Key facts & specifications
Also known as
Breast epithelial antigen BA46,HMFG,MFGM,Milk fat globule-EGF factor 8,MFG-E8,SED1
Host species
E. coli
Source organism
Escherichia coli (E.coli)
Tag
C-terminal His Tag
Molecular weight
27kDa&28kDa
Sequence fragment
Met1-Lys239 & Trp137-Cys387
Sequence
MGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGGGSGGGGWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGCLEHHHHHH
Technical note
For research use only
Identifiers & database references
Manufacturer SKU
PX-P4698
Gene ID
4240
UniProt accession
C5MKY7&Q08431
NCBI accession
AGT36556 & Q08431
Storage, stability & shipping
Storage conditions
4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Shipped at
Dry Ice
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Safety data sheet
Open SDS
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£189.00£151.20