Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) Envelope glycoprotein E2 recombinant protein

Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) Envelope glycoprotein E2 recombinant protein

100%
Manufactured by:ProteoGenix
Save 20%RUO

Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) Envelope glycoprotein E2 recombinant protein

Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) Envelope glycoprotein E2 recombinant protein from ProteoGenix; catalogue PX-

SKU:
ABM144213-1
Manufacturer SKU
PX-P6241
Product type
Recombinant Proteins
ApplicationsELISA, WB
Expression systemEukaryotic expression
Purity>85% by SDS-PAGE

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus) Envelope glycoprotein E2 recombinant protein is a ProteoGenix recombinant protein supplied under catalogue number PX-P6241 for research use only.

Host: Mammalian cells; Expression system: Eukaryotic expression; Purity: >85% by SDS-PAGE; Molecular weight: 41.38 kDa; Tag: C-Terminal His Tag; Fragment: His693-Asp1030; Buffer: 0.01M PBS, pH 7.4.; Applications: ELISA, WB.

Download the manufacturer datasheet

Key facts & specifications
Also known as
Genome polyprotein, N-terminal protease, N-pro, 3.4.22.-, Autoprotease p20, Capsid protein C, E(rns) glycoprotein, gp44/48, Envelope glycoprotein E1, gp33, Envelope glycoprotein E2, gp55, Viroporin p7, Non-structural protein 2-3, Cysteine protease NS2, 3.4.22.-, Non-structural protein 2, Serine protease NS3, 3.4.21.113, 3.6.1.15, 3.6.4.13, Non-structural protein 3, Non-structural protein 4A, NS4A, Non-structural protein 4B, NS4B, Non-structural protein 5A, NS5A, RNA-directed RNA polymerase, 2.7.7.48, NS5B, Bovine viral diarrhea virus (BVDV)
Host species
Mammalian cells
Source organism
Bovine viral diarrhea virus (isolate NADL) (BVDV) (Mucosal disease virus)
Tag
C-Terminal His Tag
Molecular weight
41.38 kDa
Sequence fragment
His693-Asp1030
Sequence
HLDCKPEFSYAIAKDERIGQLGAEGLTTTWKEYSPGMKLEDTMVIAWCEDGKLMYLQRCTRETRYLAILHTRALPTSVVFKKLFDGRKQEDVVEMNDNFEFGLCPCDAKPIVRGKFNTTLLNGPAFQMVCPIGWTGTVSCTSFNMDTLATTVVRTYRRSKPFPHRQGCITQKNLGEDLHNCILGGNWTCVPGDQLLYKGGSIESCKWCGYQFKESEGLPHYPIGKCKLENETGYRLVDSTSCNREGVAIVPQGTLKCKIGKTTVQVIAMDTKLGPMPCRPYEIISSEGPVEKTACTFNYTKTLKNKYFEPRDSYFQQYMLKGEYQYWFDLEVTDHHRD
Technical note
For research use only
Identifiers & database references
Manufacturer SKU
PX-P6241
UniProt accession
P19711
Storage, stability & shipping
Storage conditions
4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Shipped at
Dry Ice
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£349.00£279.20