Anti-ORF7a protein polyclonal antibody from ProteoGenix; catalogue PTXCOV-A559; research use only.
Know who made it. See the evidence. Buy through one marketplace.
Anti-ORF7a protein polyclonal antibody is a ProteoGenix primary antibody supplied under catalogue number PTXCOV-A559 for research use only.
Target: ORF7a: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE; Host: Rabbit; Clonality: Polyclonal Antibody; Molecular weight: 13kDa; Buffer: PBS, pH7.4, containing 0.05% proclin300, 50% glycerol; Applications: ELISA.
Available configurations: 50ug, 100ug, 1mg.
Fully tested in-house by ABMIUM, or supported by an advanced validation report from a partner reviewed by ABMIUM. Highest confidence. Non-conformities fully supported under the ABMIUM Product Promise.
Quality verified. Independent collaborator or expected-performance data available. Product meets ABMIUM quality standards.
Expected to work based on structural and biochemical data. Not yet directly tested by ABMIUM or a collaborator. No non-conformity support for this combination.
Not recommended for this application or species/sample combination. This may indicate either evidence of unsuitability or that the combination has not been tested and therefore cannot currently be recommended.
Evidence status by application and model.
| Target | WB | IHC-P | IHC-Fr | IF/ICC | Flow Cyt | IP | ChIP | ELISA |
|---|---|---|---|---|---|---|---|---|
| ORF7a |
This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.
ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.
Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.
Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.
