Anti-Human NDUFA13 Polyclonal Antibody

Anti-Human NDUFA13 Polyclonal Antibody

100%
Manufactured by:ProteoGenix
Save 20%RUO

Anti-Human NDUFA13 Polyclonal Antibody

Anti-Human NDUFA13 Polyclonal Antibody from ProteoGenix; catalogue ARO-A11945; research use only.

SKU:
ABM127984-1
Manufacturer SKU
ARO-A11945
Product type
Primary Antibodies
TargetE. coli - derived recombinant Human NDUFA13 (Met51-Thr144).
Species / reactivityHuman

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Anti-Human NDUFA13 Polyclonal Antibody is a ProteoGenix primary antibody supplied under catalogue number ARO-A11945 for research use only.

Target: E. coli - derived recombinant Human NDUFA13 (Met51-Thr144).; Host: Rabbit; Clonality: Polyclonal Antibody; Buffer: 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.; Reactivity: Human.

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications
Also known as
Anti-Gene associated with retinoic and IFN-induced mortality 19 protein, Gene associated with retinoic and interferon-induced mortality 19 protein, CI-B16.6, Cell death regulatory protein GRIM-19, NADH-ubiquinone oxidoreductase B16.6 subunit, GRIM-19, Complex I-B16.6, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13, GRIM19, NDUFA13
Host species
Rabbit
Clonality
Polyclonal
Source organism
Rabbit
Sequence
MKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Identifiers & database references
Manufacturer SKU
ARO-A11945
UniProt accession
Q9P0J0
Storage, stability & shipping
Storage conditions
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Shipped at
Blue ice (+4°C)
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£109.00£87.20