Anti-Human B3GNT3 Polyclonal Antibody

Anti-Human B3GNT3 Polyclonal Antibody

100%
Manufactured by:ProteoGenix
Save 20%RUO

Anti-Human B3GNT3 Polyclonal Antibody

Anti-Human B3GNT3 Polyclonal Antibody from ProteoGenix; catalogue ARO-A11212; research use only.

SKU:
ABM127251-1
Manufacturer SKU
ARO-A11212
Product type
Primary Antibodies
TargetE. coli - derived recombinant Human B3GNT3 (Leu165-Arg277).
Species / reactivityHuman

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Anti-Human B3GNT3 Polyclonal Antibody is a ProteoGenix primary antibody supplied under catalogue number ARO-A11212 for research use only.

Target: E. coli - derived recombinant Human B3GNT3 (Leu165-Arg277).; Host: Rabbit; Clonality: Polyclonal Antibody; Buffer: 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.; Reactivity: Human.

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications
Also known as
Anti-Beta-1,3-Gn-T3, Core1-beta3GlcNAcT, Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase, UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8, Beta3Gal-T8, B3GNT3, BGnT-3, Beta-1,3-GalTase 8, Beta-1,3-galactosyltransferase 8, b3Gal-T8, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3, Core 1 extending beta-1,3-N-acetylglucosaminyltransferase, Beta3GalT8, B3GALT8, Transmembrane protein 3, TMEM3, Beta-1,3-N-acetylglucosaminyltransferase 3, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3, UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8, Beta-3-Gx-T8, Beta3Gn-T3
Host species
Rabbit
Clonality
Polyclonal
Source organism
Rabbit
Sequence
LEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFVGQLIQNVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSR
Identifiers & database references
Manufacturer SKU
ARO-A11212
UniProt accession
Q9Y2A9
Storage, stability & shipping
Storage conditions
Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Shipped at
Blue ice (+4°C)
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£119.00£95.20