Mouse CD147/BSG Recombinant Protein, C-His

Mouse CD147/BSG Recombinant Protein, C-His

100%
Manufactured by:ProteoGenix
Save 20%RUO

Mouse CD147/BSG Recombinant Protein, C-His

Mouse CD147/BSG Recombinant Protein, C-His from ProteoGenix; catalogue ARO-P21027; research use only.

SKU:
ABM135655-1
Manufacturer SKU
ARO-P21027
Product type
Recombinant Proteins
Expression systemEukaryotic expression

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Mouse CD147/BSG Recombinant Protein, C-His is a ProteoGenix recombinant protein supplied under catalogue number ARO-P21027 for research use only.

Host: Mammalian cells; Expression system: Eukaryotic expression; Molecular weight: 36.26 kDa; Tag: C-Terminal His Tag; Fragment: Ala22-Arg325; Buffer: Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol..

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications
Also known as
5F7, BSG, Basigin, CD147, Collagenase stimulatory factor, EMMPRIN, Extracellular matrix metalloproteinase inducer, HAb18G, Hepatoma-associated antigen, Leukocyte activation antigen M6, OK blood group antigen, TCSF, Tumor cell-derived collagenase stimulatory factor
Host species
Mammalian cells
Source organism
Mouse
Tag
C-Terminal His Tag
Molecular weight
36.26 kDa
Form / buffer
Liquid
Sequence fragment
Ala22-Arg325
Sequence
AAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLTRPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR
Technical note
For research use only.
Identifiers & database references
Manufacturer SKU
ARO-P21027
UniProt accession
P18572
Storage, stability & shipping
Storage conditions
4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Shipped at
Dry Ice
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£215.00£172.00