Interferon-induced transmembrane protein 1(IFITM1)

Interferon-induced transmembrane protein 1(IFITM1)

100%
Manufactured by:ProteoGenix
Save 20%RUO

Interferon-induced transmembrane protein 1(IFITM1)

Interferon-induced transmembrane protein 1(IFITM1) from ProteoGenix; catalogue PX-P4692; research use only.

SKU:
ABM145747-1
Manufacturer SKU
PX-P4692
Product type
Recombinant Proteins
ApplicationsELISA, WB
Expression systemEukaryotic expression
Purity>90%by SDS-PAGE

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Interferon-induced transmembrane protein 1(IFITM1) is a ProteoGenix recombinant protein supplied under catalogue number PX-P4692 for research use only.

Host: Mammalian cells; Expression system: Eukaryotic expression; Purity: >90%by SDS-PAGE; Tag: C-terminal sumo tag; Fragment: Met1-Phe57; Buffer: PBS, pH7.5; Applications: ELISA, WB.

Available configurations: 50ug, 100ug.

Download the manufacturer datasheet

Download the manufacturer safety data sheet (MSDS/SDS)

Key facts & specifications
Also known as
Dispanin subfamily A member 2a,DSPA2a,Interferon-induced protein 17,Interferon-inducible protein 9-27,Leu-13 antigen, CD225,CD225, IFI17
Host species
Mammalian cells
Source organism
Homo sapiens (Human)
Tag
C-terminal sumo tag
Sequence fragment
Met1-Phe57
Sequence
MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAF
Technical note
For research use only
Identifiers & database references
Manufacturer SKU
PX-P4692
UniProt accession
P13164
Storage, stability & shipping
Storage conditions
4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Shipped at
Dry Ice
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Safety data sheet
Open SDS
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£169.00£135.20