Human IL2 recombinant protein (1-134)

Human IL2 recombinant protein (1-134)

100%
Manufactured by:ProteoGenix
Save 20%RUO

Human IL2 recombinant protein (1-134)

Human IL2 recombinant protein (1-134) from ProteoGenix; catalogue PX-P6288; research use only.

SKU:
ABM144172-1
Manufacturer SKU
PX-P6288
Product type
Recombinant Proteins
ApplicationsELISA, WB
Expression systemProkaryotic expression
Purity>90% by SDS-PAGE

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Human IL2 recombinant protein (1-134) is a ProteoGenix recombinant protein supplied under catalogue number PX-P6288 for research use only.

Host: Escherichia coli (E.coli); Expression system: Prokaryotic expression; Purity: >90% by SDS-PAGE; Molecular weight: 16.48 kDa; Tag: C-Terminal His Tag; Fragment: Met1-Thr134; Buffer: PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol; Applications: ELISA, WB.

Available configurations: 100 ug.

Key facts & specifications
Also known as
TCGF, Aldesleukin, T-cell growth factor, Interleukin-2, IL-2
Host species
Escherichia coli (E.coli)
Source organism
Homo sapiens (Human)
Tag
C-Terminal His Tag
Molecular weight
16.48 kDa
Sequence fragment
Met1-Thr134
Sequence
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADE
Technical note
For research use only.
Identifiers & database references
Manufacturer SKU
PX-P6288
UniProt accession
P60568
Storage, stability & shipping
Storage conditions
4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Shipped at
Blue ice (+4°)
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£269.00£215.20