Recombinant Human XRCC5/Ku80, N-His

Recombinant Human XRCC5/Ku80, N-His from ProteoGenix; catalogue ARO-P14031; research use only.

SKU:: ABM144710-1
Manufacturer SKU: ARO-P14031
RRID
Product type: Recombinant Proteins

Species / reactivityHomo sapiens (Human)

Expression systemProkaryotic expression

Manufacturer provenance

Manufactured by:: ProteoGenix
Sold by:: ABMIUM
Fulfilled from:: Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Recombinant Human XRCC5/Ku80, N-His is a ProteoGenix recombinant protein supplied under catalogue number ARO-P14031 for research use only.

Host: Escherichia coli (E.coli); Expression system: Prokaryotic expression; Tag: N-Terminal His Tag; Fragment: Leu384-Ile732; Buffer: 0.01M PBS, pH 7.4.; Reactivity: Homo sapiens (Human).

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications

Also known as: Lupus Ku autoantigen protein p86, XRCC5, Thyroid-lupus autoantigen, Ku86, ATP-dependent DNA helicase 2 subunit 2, CTC85, G22P2, DNA repair protein XRCC5, 86 kDa subunit of Ku antigen, TLAA, Nuclear factor IV, CTC box-binding factor 85 kDa subunit, ATP-dependent DNA helicase II 80 kDa subunit, CTCBF, Ku80, X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining), X-ray repair cross-complementing protein 5
Host species: Escherichia coli (E.coli)
Source organism: Human
Tag: N-Terminal His Tag
Form / buffer: Liquid
Sequence fragment: Leu384-Ile732
Sequence: LDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Technical note: For research use only.

Identifiers & database references

Manufacturer SKU: ARO-P14031
UniProt accession: P13010

Storage, stability & shipping

Storage conditions: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Shipped at: Dry Ice

Compliance & documents

ISO certifications: ISO 9001:2023, ISO 14001: 2023
Datasheet: Open datasheet

Frequently asked questions

Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

Delivery to Vereinigtes Königreich: typically 1 to 3 business days in transit Transit estimate after dispatch. Final shipping options are confirmed at checkout.