Recombinant Human SLC40A1, N-GST

Recombinant Human SLC40A1, N-GST

100%
Manufactured by:ProteoGenix
Save 20%RUO

Recombinant Human SLC40A1, N-GST

Recombinant Human SLC40A1, N-GST from ProteoGenix; catalogue ARO-P13728; research use only.

SKU:
ABM144175-1
Manufacturer SKU
ARO-P13728
Product type
Recombinant Proteins
Expression systemProkaryotic expression

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Recombinant Human SLC40A1, N-GST is a ProteoGenix recombinant protein supplied under catalogue number ARO-P13728 for research use only.

Host: Escherichia coli (E.coli); Expression system: Prokaryotic expression; Molecular weight: 48.59 kDa; Tag: N-Terminal GST Tag; Fragment: Trp127-Val321; Buffer: PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications
Also known as
Iron-regulated transporter 1, SLC40A1, FPN, FPN1, IREG1, SLC11A3, MSTP079, Solute carrier family 40 member 1, Ferroportin-1
Host species
Escherichia coli (E.coli)
Source organism
Human
Tag
N-Terminal GST Tag
Molecular weight
48.59 kDa
Form / buffer
Liquid
Sequence fragment
Trp127-Val321
Sequence
WVLTSCYILIITIANIANLASTATAITIQRDWIVVVAGEDRSKLANMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGLKEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTV
Technical note
For research use only.
Identifiers & database references
Manufacturer SKU
ARO-P13728
UniProt accession
Q9NP59
Storage, stability & shipping
Storage conditions
4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Shipped at
3-5 days if in stock; 3-5 weeks if production needed
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Datasheet
Open datasheet
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£209.00£167.20