Human CGA recombinant protein

Human CGA recombinant protein

100%
Manufactured by:ProteoGenix
Save 20%RUO

Human CGA recombinant protein

Human CGA recombinant protein from ProteoGenix; catalogue PX-P6562; research use only.

SKU:
ABM140467-1
Manufacturer SKU
PX-P6562
Product type
Recombinant Proteins
Expression systemEukaryotic expression

Manufacturer provenance

Manufactured by:
ProteoGenix
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Human CGA recombinant protein is a ProteoGenix recombinant protein supplied under catalogue number PX-P6562 for research use only.

Host: Mammalian cells; Expression system: Eukaryotic expression; Molecular weight: 39.20 kDa; Tag: C-Terminal Fc Tag; Fragment: Ala25-Ser116; Buffer: PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol..

Available configurations: 50ug, 100ug, 1mg.

Key facts & specifications
Also known as
Lutropin alpha chain, Thyrotropin alpha chain, Follitropin alpha chain, Luteinizing hormone alpha chain, Thyroid-stimulating hormone alpha chain, FSH-alpha, LSH-alpha, Glycoprotein hormones alpha chain, CGA, TSH-alpha, Choriogonadotropin alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, CG-alpha, Chorionic gonadotrophin subunit alphaFollicle-stimulating hormone alpha chain,
Host species
Mammalian cells
Source organism
Human
Tag
C-Terminal Fc Tag
Molecular weight
39.20 kDa
Form / buffer
Liquid
Sequence fragment
Ala25-Ser116
Sequence
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Identifiers & database references
Manufacturer SKU
PX-P6562
UniProt accession
P01215 & P01225
Storage, stability & shipping
Shipped at
Dry Ice
Compliance & documents
ISO certifications
ISO 9001:2023, ISO 14001: 2023
Frequently asked questions
Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

ProteoGenix
£179.00£143.20