Anti-VWF Polyclonal antibody

Anti-VWF Polyclonal antibody from ProteoGenix; catalogue ARO-A14224; research use only.

SKU:: ABM130263-1
Manufacturer SKU: ARO-A14224
RRID
Product type: Primary Antibodies

TargetE. coli - derived recombinant Human VWF (Ala23-Lys219).

Manufacturer provenance

Manufactured by:: ProteoGenix
Sold by:: ABMIUM
Fulfilled from:: Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Anti-VWF Polyclonal antibody is a ProteoGenix primary antibody supplied under catalogue number ARO-A14224 for research use only.

Target: E. coli - derived recombinant Human VWF (Ala23-Lys219).; Host: Rabbit; Clonality: Polyclonal Antibody; Buffer: 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300..

Available configurations: 50ug, 100ug, 1mg.

Download the manufacturer datasheet

Key facts & specifications

Also known as: Anti-von Willebrand antigen II,von Willebrand factor,F8VWF,vWF,VWF,
Host species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Source organism: Rabbit
Sequence: AEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQK

Identifiers & database references

Manufacturer SKU: ARO-A14224
UniProt accession: P04275

Storage, stability & shipping

Storage conditions: Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Shipped at: Blue ice (+4°C)

Compliance & documents

ISO certifications: ISO 9001:2023, ISO 14001: 2023
Datasheet: Open datasheet

Frequently asked questions

Who manufactured this product?

This product is manufactured by ProteoGenix and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

Delivery to Vereinigtes Königreich: typically 1 to 3 business days in transit Transit estimate after dispatch. Final shipping options are confirmed at checkout.