Manufactured by:Boster Bio
ABMIUM Verified™RUO

Anti-SARS-CoV-2 NSP9 Antibody

Primary Antibody supplied by Boster Bio

SKU:
ABM23579-1
Product type
Primary Antibodies
TargetGlutamate receptor 1
ApplicationsELISA, Flow Cytometry, IHC, IHC-P, WB
Species / reactivityHuman

Manufacturer provenance

Manufactured by:
Boster Bio
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Anti-SARS-CoV-2 NSP9 Antibody is a research-use antibody from Boster Bio for studying Glutamate receptor 1 in ELISA, Flow Cytometry, IHC, IHC-P, WB workflows with listed reactivity for Human. Specifications and supporting documents below should be reviewed when planning the experiment.

Boster Bio Anti-SARS-CoV-2 NSP9 Antibody catalog # A30395. Tested in ELISA applications. This antibody reacts with Human.

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.

Product information

Key facts & specifications
Also known as
Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp10; Non-structural protein 10; Growth factor-like peptide; GFL; rep
Host species
Rabbit
Clonality
Polyclonal
Isotype
Rabbit IgG
Dilution range
ELISA, 0.001-0.1μg/ml, Human
Immunogen
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Observed band
140 kDa, 130 kDa, 110 kDa
Molecular weight
16693 MW
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Purification
Immunogen affinity purified.
Form / buffer
Lyophilized
Sequence fragment
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Validation & performance evidence
ABMIUM Validated™ ABMIUM Verified™ Expected performance Not suitable

Application validation matrix

Evidence status by application and model.

SpeciesWBIHCIHC-PIHC-FIF/ICCFlow CytometryELISAIP
Human
Identifiers & database references
Supplier SKU / catalogue number
A30395
Gene symbol
rep
Gene ID
43740578
UniProt accession
P0DTC1/P0DTD1
Storage, stability & shipping
Shelf life
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Storage conditions
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Shipped at
Ambient or cold-chain dependent on product format
Short-term storage
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Long-term storage
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Storage buffer
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Storage warning
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Compliance & documents
CE marked
No
Datasheet
Open datasheet
Safety data sheet
Open SDS
Frequently asked questions
Who manufactured this product?

This product is manufactured by Boster Bio and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

Boster Bio
£367.00