Primary Antibody ABMIUM Verified™Collaborator Tested
ABM-23579

Anti-SARS-CoV-2 NSP9 Antibody

ABMIUM Verified™|Collaborator Tested|Boster Bio

Primary Antibody supplied by Boster Bio Read more ›

Related formats
Placeholder image
Zoom
Placeholder image

Product Description

Boster Bio Anti-SARS-CoV-2 NSP9 Antibody catalog # A30395. Tested in ELISA applications. This antibody reacts with Human.

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.

Product information

Supplier Boster Bio
ABMIUM evidence status ABMIUM Verified™ collaborator-tested data
Catalogue reference A30395
Product category Primary Antibodies
Reactive species Human
Tested applications ELISA, Flow Cytometry, IHC, IHC-P, WB
Available conjugations Unconjugated, Biotin, Cy3, Fluoro488, Fluoro550, Fluoro594, FITC, HRP, APC, PE, Fluoro647
Gene name rep
Protein name Glutamate receptor 1
Immunogen NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Host Rabbit
Clonality Polyclonal
Isotype Rabbit IgG
Purification Immunogen affinity purified.
Storage Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
UniProt P0DTC1/P0DTD1
NCBI Gene ID 43740578

Available variants

Conjugation Size
Unconjugated 100 μg/vial
Biotin 100 μg/vial
Cy3 100 μg/vial
Fluoro488 100 μg/vial
Fluoro550 100 μg/vial
Fluoro594 100 μg/vial
FITC 100 μg/vial
HRP 100 μg/vial
APC 100 μg/vial
PE 100 μg/vial
Fluoro647 100 μg/vial

Key Facts

Product type Primary Antibody Target: Glutamate receptor 1
Target Glutamate receptor 1
Also known as Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp10; Non-structural protein 10; Growth factor-like peptide; GFL; rep
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Species reactivity Human
Observed band 140 kDa, 130 kDa, 110 kDa
Form / buffer Lyophilized
Shelf life Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Host species Rabbit
Clonality Polyclonal
Isotype Rabbit IgG
Conjugation Unconjugated|Biotin|Cy3|Fluoro488|Fluoro550|Fluoro594|FITC|HRP|APC|PE|Fluoro647
Tested applications
ELISAFlow CytometryIHCIHC-PWB
Dilution range ELISA, 0.001-0.1μg/ml, Human
Immunogen NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Purification Immunogen affinity purified.
Why researchers trust ABMIUM
2,000+ Researchers trust us
50,000+ Citations
ISO 9001 Certified Collaborators

Reactivity & Application Validation

1 species
ABMIUM Validated™ ABMIUM Verified™ Expected Performance Not suitable
SpeciesWBIHCIHC-PIHC-FIF/ICCFLOW CYTOMETRYELISAIP
Human

Specifications

Target
Glutamate receptor 1
Also known as
Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp10; Non-structural protein 10; Growth factor-like peptide; GFL; rep
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Form / buffer
Lyophilized
Host species
Rabbit
Clonality
Polyclonal
Isotype
Rabbit IgG
Conjugation
Unconjugated|Biotin|Cy3|Fluoro488|Fluoro550|Fluoro594|FITC|HRP|APC|PE|Fluoro647
Species reactivity
Human
Tested applications
ELISAFlow CytometryIHCIHC-PWB
Immunogen
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Observed band
140 kDa, 130 kDa, 110 kDa
Dilution range
ELISA, 0.001-0.1μg/ml, Human
Purification
Immunogen affinity purified.

Storage & Stability

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Shipped at
Ambient or cold-chain dependent on product format
Short-term storage
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Long-term storage
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Storage conditions
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Storage buffer
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Shelf life
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.

Compliance & Certifications

RUO
For Research Use Only

Not intended for diagnostic or therapeutic use.

Customer Reviews

Recently Viewed