Collaborator Boster Bio
Primary AntibodiesABMIUM Verified™Collaborator Tested
ABM-23588

Anti-SARS-CoV-2 NSP8 Antibody

ABMIUM Verified™|Collaborator Tested|Boster Bio

Primary Antibody supplied by Boster Bio Read more ›

Placeholder image
Zoom
Placeholder image

Product Description

Anti-SARS-CoV-2 NSP8 Antibody is a research-use antibody from Boster Bio for studying Laminin subunit alpha-1; Laminin subunit alpha-2; Laminin subunit beta-1; Laminin subunit beta-2 in ELISA, Flow Cytometry, IHC, IHC-P, WB workflows with listed reactivity for Human. Specifications and supporting documents below should be reviewed when planning the experiment.

Boster Bio Anti-SARS-CoV-2 NSP8 Antibody catalog # A34002. Tested in ELISA applications. This antibody reacts with Human.

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.

Product information

Key Facts

Product typePrimary Antibodies Target: Laminin subunit alpha-1; Laminin subunit alpha-2; Laminin subunit beta-1; Laminin subunit beta-2
Collaborator Boster Bio
Partner model A34002
Target Laminin subunit alpha-1; Laminin subunit alpha-2; Laminin subunit beta-1; Laminin subunit beta-2
Reactivity Human
Applications ELISA,Flow Cytometry,IHC,IHC-P,WB
ConjugationUnconjugated|Biotin|Cy3|Fluoro488|Fluoro550|Fluoro594|FITC|HRP|APC|PE|Fluoro647
Dilution rangeELISA, 0.001-0.1μg/ml, Human
Host Rabbit
Clonality Polyclonal
Isotype Rabbit IgG
Immunogen AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Concentration Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Purification Immunogen affinity purified.
Shelf life Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
AvailabilityAvailable
Why ABMIUM?
2,000+ Researchers trust us
50,000+ Citations
ISO 9001 Certified Collaborators
Independently handpicked Products selected for quality and fit

Application Validation Matrix

1 species
ABMIUM Validated™ ABMIUM Verified™ Expected Performance Not suitable
SpeciesWBIHCIHC-PIHC-FIF/ICCFlow CytometryELISAIP
Human

Specifications

Target
Laminin subunit alpha-1; Laminin subunit alpha-2; Laminin subunit beta-1; Laminin subunit beta-2
Also known as
Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp10; Non-structural protein 10; Growth factor-like peptide; GFL; rep
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Form / buffer
Lyophilized
Host species
Rabbit
Clonality
Polyclonal
Isotype
Rabbit IgG
Conjugation
Unconjugated|Biotin|Cy3|Fluoro488|Fluoro550|Fluoro594|FITC|HRP|APC|PE|Fluoro647
Species reactivity
Human
Tested applications
ELISAFlow CytometryIHCIHC-PWB
Immunogen
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
Observed band
140 kDa, 130 kDa, 110 kDa
Dilution range
ELISA, 0.001-0.1μg/ml, Human
Purification
Immunogen affinity purified.

Storage & Stability

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Shipped at
Ambient or cold-chain dependent on product format
Short-term storage
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Storage buffer
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Shelf life
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.

Compliance & Certifications

ABMIUM
ABMIUM Verified

Collaborator meets ABMIUM quality standards and overall product performance standards have been met.

RUO
Research Use Only

For research applications. Not for diagnostic use.

Customer Reviews

No customer reviews yet.