Primary Antibody supplied by Boster Bio
Know who made it. See the evidence. Buy through one marketplace.
Anti-Integrin beta 3 / CD61 Rabbit Monoclonal Antibody is a research-use antibody from Boster Bio for studying Integrin beta-3 in IHC, IP, WB workflows with listed reactivity for Human. Specifications and supporting documents below should be reviewed when planning the experiment.
Boster Bio Anti-Integrin beta 3 / CD61 Rabbit Monoclonal Antibody catalog # M00587-2. Tested in WB, IHC, IP applications. This antibody reacts with Human.| Supplier | Boster Bio |
|---|---|
| ABMIUM evidence status | ABMIUM Verified™ collaborator-tested data |
| Catalogue reference | M00587-2 |
| Product category | Primary Antibodies, Rabbit Monoclonal Antibodies |
| Reactive species | Human |
| Tested applications | IHC, IP, WB |
| Available conjugations | Unconjugated |
| Gene name | ITGB3 |
| Protein name | Integrin beta-3 |
| Immunogen | A synthesized peptide derived from human Integrin beta 3 / CD61. EDYPVDILSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDAFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSC |
| Host | Rabbit |
| Clonality | Monoclonal |
| Isotype | IgG |
| Purification | Affinity-chromatography |
| Storage | Store at -20℃ for one year. For short term storage and frequent use, store at 4℃ for up to one month. Avoid repeated freeze-thaw cycles. |
| UniProt | P05106 |
| NCBI Gene ID | 3690 |
| Conjugation | Size |
|---|---|
| Unconjugated | 100 μl/vial |
Fully tested in-house by ABMIUM. Highest confidence. Non-conformities fully supported under the ABMIUM Product Promise.
Quality verified. Independent collaborator or expected-performance data available. Product meets ABMIUM quality standards.
Expected to work based on structural and biochemical data. Not yet directly tested by ABMIUM or a collaborator. No non-conformity support for this combination.
Not recommended for this application or species/sample combination. This may indicate either evidence of unsuitability or that the combination has not been tested and therefore cannot currently be recommended.
Evidence status by application and model.
| Species | WB | IHC | IHC-P | IHC-F | IF/ICC | Flow Cytometry | ELISA | IP |
|---|---|---|---|---|---|---|---|---|
| Human |
This product is manufactured by Boster Bio and sold through ABMIUM without relabelling.
ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.
Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.
Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.