ABM-23581
Anti-SARS-CoV-2 ORF8 Antibody
ABMIUM Verified™|Collaborator Tested|Boster Bio
Primary Antibody supplied by Boster Bio Read more ›
Related formats
Zoom
Product Description
Boster Bio Anti-SARS-CoV-2 ORF8 Antibody catalog # A33995. Tested in ELISA applications. This antibody reacts with Human.
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF8 encodes a viral accessory protein.
Product information
| Supplier | Boster Bio |
|---|---|
| ABMIUM evidence status | ABMIUM Verified™ collaborator-tested data |
| Catalogue reference | A33995 |
| Product category | Primary Antibodies |
| Reactive species | Human |
| Tested applications | ELISA, Flow Cytometry, IHC, IHC-P, WB |
| Available conjugations | Unconjugated, Biotin, Cy3, Fluoro488, Fluoro550, Fluoro594, FITC, HRP, APC, PE, Fluoro647 |
| Gene name | 8 |
| Protein name | ORF8 protein |
| Immunogen | AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | Rabbit IgG |
| Purification | Immunogen affinity purified. |
| Storage | Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles. |
| UniProt | P0DTC8 |
| NCBI Gene ID | 43740577 |
Available variants
| Conjugation | Size |
|---|---|
| Unconjugated | 100 μg/vial |
| Biotin | 100 μg/vial |
| Cy3 | 100 μg/vial |
| Fluoro488 | 100 μg/vial |
| Fluoro550 | 100 μg/vial |
| Fluoro594 | 100 μg/vial |
| FITC | 100 μg/vial |
| HRP | 100 μg/vial |
| APC | 100 μg/vial |
| PE | 100 μg/vial |
| Fluoro647 | 100 μg/vial |
Key Facts
Product type
Primary Antibody›
Target: ORF8 protein
| Target | ORF8 protein |
| Also known as | ORF8 protein; ORF8; Non-structural protein 8; ns8 |
| Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
| Species reactivity | Human |
| Observed band | 140 kDa, 130 kDa, 110 kDa |
| Form / buffer | Lyophilized |
| Shelf life | Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles. |
| Host species | Rabbit |
| Clonality | Polyclonal |
| Isotype | Rabbit IgG |
| Conjugation | Unconjugated|Biotin|Cy3|Fluoro488|Fluoro550|Fluoro594|FITC|HRP|APC|PE|Fluoro647 |
| Tested applications |
ELISAFlow CytometryIHCIHC-PWB |
| Dilution range | ELISA, 0.001-0.1μg/ml, Human |
| Immunogen | AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
| Purification | Immunogen affinity purified. |
Why researchers trust ABMIUM
2,000+
Researchers trust us
50,000+
Citations
ISO 9001
Certified Collaborators
Reactivity & Application Validation
1 species| Species | WB | IHC | IHC-P | IHC-F | IF/ICC | FLOW CYTOMETRY | ELISA | IP |
|---|---|---|---|---|---|---|---|---|
| Human |
Specifications
Target
ORF8 protein
Also known as
ORF8 protein; ORF8; Non-structural protein 8; ns8
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Form / buffer
Lyophilized
Host species
Rabbit
Clonality
Polyclonal
Isotype
Rabbit IgG
Conjugation
Unconjugated|Biotin|Cy3|Fluoro488|Fluoro550|Fluoro594|FITC|HRP|APC|PE|Fluoro647
Species reactivity
Human
Tested applications
ELISAFlow CytometryIHCIHC-PWB
Immunogen
AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Observed band
140 kDa, 130 kDa, 110 kDa
Dilution range
ELISA, 0.001-0.1μg/ml, Human
Purification
Immunogen affinity purified.
Storage & Stability
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Shipped at
Ambient or cold-chain dependent on product format
Short-term storage
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Long-term storage
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Storage conditions
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Storage buffer
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Shelf life
Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.
Compliance & Certifications
RUO
For Research Use Only
Not intended for diagnostic or therapeutic use.
Customer Reviews
Recently Viewed