Manufactured by:Elabscience
Save 20%ABMIUM Verified™RUO

Recombinant Swine GM-CSF protein(His Tag)

Recombinant Swine GM-CSF protein(His Tag) supplied by Elabscience with collaborator-provided technical specifications.

SKU:
ABM20248-1
Product type
Cytokines
TargetGM-CSF
Species / reactivityPorcine
Purity>98% by SDS-PAGE

Manufacturer provenance

Manufactured by:
Elabscience
Sold by:
ABMIUM
Fulfilled from:
Manufacturer facility or confirmed fulfilment location

Know who made it. See the evidence. Buy through one marketplace.

Product description

Recombinant Swine GM-CSF protein(His Tag) is a research-use recombinant protein from Elabscience preparation representing GM-CSF supplied as Lyophilized. Review the expression, purity, formulation and storage specifications below before selecting it for an assay or functional workflow.

Key facts & specifications
Also known as
CSF2
Modification
N-His
Molecular weight
17.1 kDa
Form / buffer
Lyophilized
Activity
Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 3 ng/mL.
Sequence
MWLQNLLLLGTVVCSISAPTRPPSPVTRPWQHVDAIKEALSLLNNSNDTAAVMNETVDVVCEMFDPQEPTCVQTRLNLYKQGLRGSLTRLKSPLTLLAKHYEQHCPLTEETSCETQSITFKSFKDSLNKFLFTIPFDCWGPVKK
Technical note
Please refer to the printed manual for detailed information.
Validation & performance evidence
ABMIUM Validated™ ABMIUM Verified™ Expected performance Not suitable

Application validation matrix

Evidence status by application and model.

SpeciesBioactivityBindingCell-BasedIn VivoELISA Capture
Porcine
Identifiers & database references
Supplier SKU / catalogue number
PKSS000024_20ug
Gene symbol
GM-CSF
UniProt accession
Q29118
Storage, stability & shipping
Shelf life
12 months
Shipped at
This product is provided as lyophilized powder which is shipped with ice packs.
Short-term storage
Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Long-term storage
Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80℃. Reconstituted protein solution can be stored at 4-8℃ for 2-7 days. Aliquots of reconstituted samples are stable at < -20℃ for 3 months.
Aliquoting guidance
Reconstitute entire vial immediately. Aliquot working stock; avoid repeated freeze-thaw.
Compliance & documents
REACH compliant
Yes
ISO certifications
ISO 9001:2015, ISO 14001:2015, ISO 45001:2018
Datasheet
Open datasheet
Product manual
Open manual
Safety data sheet
Open SDS
Frequently asked questions
Who manufactured this product?

This product is manufactured by Elabscience and sold through ABMIUM without relabelling.

Can ABMIUM ship this product internationally?

ABMIUM supports global orders. Availability, shipping requirements and applicable import arrangements are confirmed before fulfilment where required.

Can I check suitability before ordering?

Yes. Send your target, sample, application and experimental conditions through ABMIUM MATCH or technical support.

Is this product for clinical use?

Unless the listing expressly states otherwise, ABMIUM products are supplied for research use only and are not for diagnostic or therapeutic use.

Elabscience
£267.00£213.60